SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_09250 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bm1_09250
Domain Number - Region: 19-135
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.00235
Family DPP6 N-terminal domain-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_09250
Sequence length 139
Comment | Brugia malayi hypothetical protein (140 aa)
Sequence
MILRPLFTFHGYMILRPLFTFHDTQTVIHISWIHDAQTVIYISWIHDTQTVIHISWLHDA
QIVIHISWIHDNSDRYSHFMILRPLFTFHGYMILRPLFTFHDAQTVIYISWIHDTQTVIH
ISWLHDAQTVIYISWIHDA
Download sequence
Identical sequences A8NT52
XP_001893322.1.25112 Bm1_09250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]