SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_09675 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_09675
Domain Number 1 Region: 76-186
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.84e-29
Family Ankyrin repeat 0.00065
Further Details:      
 
Domain Number 2 Region: 6-79
Classification Level Classification E-value
Superfamily SH3-domain 3.94e-21
Family SH3-domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_09675
Sequence length 219
Comment | Brugia malayi Variant SH3 domain containing protein (220 aa)
Sequence
MTESKPPKPAPKPGRVTVYRALYDYKAQNDKELSFSEGDLLYVSDSSNDVQWWPARCRNQ
IGLIPANYVKTAEYIEYPLHDAAKRGNIEYVRECLDNAVSVNGLDKSGSTPLYWSSHGGH
VAVVKLLCSIPSICISAQNKIGDTALHAAAWKNHLECVEVLLKYGANTTIQNNERKRPID
LAXDPEIRALIQLAMRQTVDTSNFRNDYSSESEQEIDDI
Download sequence
Identical sequences XP_001893408.1.25112 Bm1_09675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]