SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_09735 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_09735
Domain Number 1 Region: 44-298
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.21e-42
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 235-461
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.4e-19
Family Ankyrin repeat 0.0044
Further Details:      
 
Domain Number 3 Region: 510-556
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000129
Family SOCS box-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_09735
Sequence length 564
Comment | Brugia malayi ankyrin repeat and SOCS box protein 3, putative (565 aa)
Sequence
MLLFTINGALCRRCVIARSDWTSSSIPEFEEESIVVESNVTVGVACRLGNVELTQQLLHA
GYGAFPDDRSWWPIHEAAYGLHLDCCKVLVESGRCNLNAQAHDSVTPLMLVCRMSSRHDE
ALEVARYLLDNGANPNSRTLDEMTPLIQAIKSKNTALALLLIDRGANPLDVWYDGWSALH
ESADTKDLVIMQRLISLGADIFAVDVKRHTALMVAVQENFFPGGSRIWLIYQWKNGLTCV
MAAADAGFEDILLLLINHGADCNITLHPIWGDDGSRIHAIAAAALNNHPKCVELLIPHVN
KEILKETEIDPVSAAAYSGSYECICLLLDAGFSTEVPMCSCEPVGMIIPYLRPLFSRRYH
TPLREAVRKGYTLVVERLLKAGAKMTYVKNCFSPFLFAFRNRIDPAILYKFLENDVDINA
MSVKRTCDVPDALVSALGTCNRRQLLLLLSCGLDPALKNWCKCNNGYSLMYDVMQTTYVT
DVDKLMKLLVLFSSGIPSCCNEVAEVIGAQPKIPKLLHLCRLAVRKCFRTSKLLHGRFLD
DLPIPKSLRDYMIFHPIPEELRPS
Download sequence
Identical sequences Bm1_09735 XP_001893420.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]