SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_10035 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_10035
Domain Number 1 Region: 83-231
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000314
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 2 Region: 20-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000837
Family Growth factor receptor domain 0.0042
Further Details:      
 
Domain Number 3 Region: 251-292
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000813
Family EGF-like domain of nidogen-1 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_10035
Sequence length 293
Comment | Brugia malayi GCC2 and GCC3 family protein (293 aa)
Sequence
VIPNGRPDLNSFELKERHLCEIGTVSVRNLCVPCAPGSFYDLTTHTCKLCMTDEYQPRAA
QTSCLPCPRGYITTAPGSALLTDCKNACDAGSMFNISSGICEPCGFGFYQPAPGAFSCIP
CGVGKTTLKETSIAEDECRDECPDGEHLTQVGVCLPCPQGTYRTRGVHKSCVDCPPGTTT
EGIASVRRMQCNTPKCSAGQFLVTTTKQCQFCPRGTFQDEEIQTVCKLCPPDHTTASQGA
TQASQCYSTNQCATGEDNCSWHAVCIDLPDDNDIPSYQCKCKPGYKGNGTHCQ
Download sequence
Identical sequences XP_001893480.1.25112 Bm1_10035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]