SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_10230 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_10230
Domain Number 1 Region: 420-541
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000377
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 336-459
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000314
Family Growth factor receptor domain 0.016
Further Details:      
 
Weak hits

Sequence:  Bm1_10230
Domain Number - Region: 222-257
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00111
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_10230
Sequence length 631
Comment | Brugia malayi Calcium binding EGF domain containing protein (632 aa)
Sequence
IRRDGAIGLSAVPMKPSKIPSPQPVIAIYWMAAQGGKVHYRESNDSSLLHLVENEVNIQY
RYGSSFKPTAVLIVTWENTHEITEPNLEGNSFQVALIMSDSGTFAHIVYSKLNSNKNAVA
GFSGLDGHYSLPGSGTQDAIQLAEKSDIGIPGEFLFRIDSDQVFLCGAGYKGEECAETXA
KAEWGLDCTRQCHCDGGAQCNAETGACPGGKCNPGWTGAPICEDDVDECAEEDDLCPREQ
PDCVNTAGAYLCICYEYDNITNTCKGMSSFKSEKSEPIAVNVVSVQPVLATTTFALNSRT
TRHPSTTTTQLSTQTTLFNDSKIIQFTPPPTKKTALGIASSNCHCDENAECTGGVCKCKS
GWTGDGKSCVDINECFGESNICGAHAICENSLGSYSCQCNIGYIFDRNGKCIDLDECAEG
IVVCGGSKNSSICVNIDGGYECRCAPGYAGSPDSPHGCVDVNECQLSDFYCGEKGVCKNL
VGSYECECADGFQRDQYTGQCVDIDECKYDPCDKAAVCTNLHGSFQCTCIDGFVGNGVEC
HETILFPVDKPTLEVPARINAVADYLMVEPLRLFGRTYRTLYISSNGGISFGEPLPLKLD
GNVRFPAFLPLYQHYTFQDSSKVVLKVIDGW
Download sequence
Identical sequences Bm1_10230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]