SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_10655 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_10655
Domain Number 1 Region: 30-127
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000467
Family SPRY domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_10655
Sequence length 148
Comment | Brugia malayi SPRY domain containing protein (149 aa)
Sequence
MIFKFYNLSYAVTLGDDVVLLKNGQRICGSGIWGIGLATRSAILNSVPVTANCWVLRQDG
QVVANGEVLGKLDEPIDESDCIGVAFDHVELKFYKNGVLLPLSISNVKGQVYPIIYVGDN
AILDVAFRSFSYNAPVGYEEIMLEQTIL
Download sequence
Identical sequences Bm1_10655 XP_001893603.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]