SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_11275 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_11275
Domain Number 1 Region: 14-93
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000269
Family V set domains (antibody variable domain-like) 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_11275
Sequence length 107
Comment | Brugia malayi hypothetical protein (108 aa)
Sequence
MLACLAYDDVCENVTNVEAKLGQTVQLKFNKXTGNIDIELKYPENGAIYQKAIIKDGKTT
KYGMERFGNRITYINGSLIIRNVKESDAASYTYKLGHYSQKIKLILS
Download sequence
Identical sequences XP_001893724.1.25112 Bm1_11275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]