SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_11355 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_11355
Domain Number 1 Region: 284-450,492-618
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.69e-55
Family Tandem AAA-ATPase domain 0.00075
Further Details:      
 
Domain Number 2 Region: 77-246
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.23e-37
Family SPRY domain 0.0042
Further Details:      
 
Domain Number 3 Region: 2-67
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000292
Family Tandem AAA-ATPase domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_11355
Sequence length 729
Comment | Brugia malayi ATP-dependent helicase DDX1, putative (730 aa)
Sequence
MTAFEELGVLPELGKAVDEMEWTLPTDIQSEAIPAILGGGDVLMAAETGSGKTGAFCLPV
LQIVWESLRDSMLGKARKSTNSIGERWCLNVHDRDNNLAIDPDGLLCQSRDPKAWNGTRC
TRGVVGKGKYYYEGTVTDDGLCRLGWSAANAVLDLGTDNKSFGYGGTGKKSYNRQFDNYG
TSFTLSDTIGCMLDLDNGTIAFSKNGKHLGKAFDIPEALRNTALYPAVVLKNAEIRFNFG
ETEFKYLSKGYIAVCKASSENTVISPNGSSNVNDXKKITEPNAPACIILEPTKELAEQTD
GQLKTFKKYLKEPIIRNALVIGSIPVNEQLRIIMSGIDIITCTPGRLEDFIQSGKILLSN
VRFFILDEADSLVSAKNHLPTIERIHAALPKITALGERLQMIVCSATLHNFDVKKLADRM
MHFPQWVDLKGQDSVPETVHHVVCKVDAKIDRMWIRLKPQERVQTDGIHANDEIRPGSDY
PETLSEGTKILKGEYVIKAIRQCNMDQGIIFCRTKLDCDNLERYLXRKAQDLTCVCLHGD
RRPDERTRNLDAFKKGKAKFLICTDVAARGIDVKGIPFVINVTLPDEKANYLHRIGRVGR
AERMGLAISLVSAYPEKVWYHKCPSRGVNCSNTALITQRGCAIWYDEPKLLEDIEEHLGV
TVPQIDNDFIVPVDEFDGKVVYGTKRTNAGSLYEGHAVQLSGAVAQLADLERSLQLSYLR
MFTAAEKGK
Download sequence
Identical sequences Bm1_11355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]