SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_11475 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_11475
Domain Number 1 Region: 110-310
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.27e-28
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 2 Region: 313-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000146
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  Bm1_11475
Domain Number - Region: 23-80
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000422
Family Laminin G-like module 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_11475
Sequence length 353
Comment | Brugia malayi Thrombospondin N-terminal -like domain
Sequence
containingproteinXXXXaaXMTLNVDNLNDEIRQYAPEIDWLINSFAYLGGIPKNK
NIPEIDVENFHGCLKKVKYEADAYLINFITLADQGYGQSIIRSAGELTFSCNKQALYADV
FSFNTGQHFITLPKWNSVASGSFQLRTQEFDGLILYHGSLPTTKTGYDYFAFELIDGHLF
MIINLGSGHIRLQTTAEKITDGAVWHSVTLERMGRSGTVIVDNIKTDFSTPGVSANLIIE
EPIYLGAVPWPSNESDPVDFHVPSPIWTANLRKGYIGCLKGIRINGISPNIASIFQEQQK
NFKKGISYGCSANVNQDFCALSPCKNFGRCENGYNSFRCDCSVSAMEGILCDK
Download sequence
Identical sequences Bm1_11475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]