SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_11645 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_11645
Domain Number 1 Region: 5-162
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.47e-65
Family Neutral endopeptidase (neprilysin) 0.0000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_11645
Sequence length 162
Comment | Brugia malayi peptidase family M13 containing protein (163 aa)
Sequence
MIITGSLYDMNGNLNNWWSKESYKNFRNKAQCFIEQYDSYKVPNTDFKVNGKLTLGENIA
DNGGIKQSFRAYKKYIEQIGHSAHKLPGMSKFTDEQIFFLSFAQVWCGHQTKEAQIKQVL
TNEHSPAKYRVNGPLSNLPEFSQAFNCSFGSLLNPQKRCSXW
Download sequence
Identical sequences Bm1_11645 XP_001893799.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]