SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_11675 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_11675
Domain Number 1 Region: 61-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000286
Family I set domains 0.047
Further Details:      
 
Domain Number 2 Region: 169-253
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000171
Family I set domains 0.064
Further Details:      
 
Domain Number 3 Region: 2-58
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000704
Family V set domains (antibody variable domain-like) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_11675
Sequence length 263
Comment | Brugia malayi Immunoglobulin domain containing protein (263 aa)
Sequence
MKGNGPLPPGVQQHDGILNIPSAQRQHAGSYICSASDPIGYKPPIDSPVARLIVRPASNP
LVDPPEQTVSENQPAQFRCWVPGNPTAILHWRRADGRPLGYGVSDNQGILSIPRAQMSDA
GEYICSARSVDDGTPVDSSPASFRSYELHTTEHSLMGEQSKNLQKPEVDPKHEMVYEGDP
AMFRCWLPTNLNAHLKWSRADGTPLPNSAFDDGTGTLYYLRAHVSDSDFYVCKYITENGS
KILESDPVQLKVKPYEQRKEIKK
Download sequence
Identical sequences Bm1_11675 XP_001893805.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]