SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_12300 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_12300
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily Fibronectin type III 1.61e-23
Family Fibronectin type III 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_12300
Sequence length 157
Comment | Brugia malayi Fibronectin type III domain containing protein (157 aa)
Sequence
KTHTLITDLEPNTEYSFRVNAFNRHGDGEFSASKKILTGGLPPSEPQTHSVNLLNDEAPL
RARVDWKPPKFTYNLPINKYLIWYKPFEHIDARKLEVPGTQNFAILDGLFMGRLYEINIA
AENDDGVGVNATEWLTTPVGIPEAEPLNVRYEINANQ
Download sequence
Identical sequences Bm1_12300 XP_001893930.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]