SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_13745 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_13745
Domain Number 1 Region: 3-79
Classification Level Classification E-value
Superfamily BolA-like 8.11e-26
Family BolA-like 0.00043
Further Details:      
 
Domain Number 2 Region: 237-336
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.52e-25
Family Ankyrin repeat 0.00089
Further Details:      
 
Domain Number 3 Region: 112-198
Classification Level Classification E-value
Superfamily Acyl-CoA binding protein 4.71e-19
Family Acyl-CoA binding protein 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_13745
Sequence length 358
Comment | Brugia malayi BolA-like protein (359 aa)
Sequence
MNATIQQKLEIALKPSHLDIEDFSDGCGLKFRLIIVSDSFDNKTTLASHRLVYEVLKEEM
QLIHALEIKTYTPEKWNAIEESKEKDLLKLTSGGSTSEDTEQQQNEEISERLATEFASAC
TYLPIAISEGLISREDQLYFYARYKLVTYGKADPSRRPRIYDIASREKFDAWLALSNMST
AEAMRQYVSRLVELNLGWDASQTYRIRYGVRPSTMVDAESTETESSGMSLEQIEWFAALD
EGNVKKLKDLLVSNLALLEERNENQLTALHWASDRGKLELVEFLVDAGADVNIQDYGGQT
PLHYAVSCSHRSVTDFLLKNGADPAVADFEGNCPLDIVSDAVIRKMLEDAVPERETKP
Download sequence
Identical sequences XP_001894213.1.25112 Bm1_13745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]