SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_13915 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bm1_13915
Domain Number - Region: 319-400
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0019
Family Astacin 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_13915
Sequence length 412
Comment | Brugia malayi Nematode astacin protease protein 9, isoform c,
Sequence
putativeXXXXaaXMLLILITCTEIFRGINCKPQMIMRHSPSSQQLPPILMPANNRPES
DDRLLLRMLSPPPPPLPPPPPLLPPPPLPPPLPLPPSPLLLPPHSSLLPLSFLNVDDIPF
LMDHFAPTPFDHIPPRVFQQIQMFCYRYPAHSKCRKKEWITVQTVSFPTQKKYPQVDVLK
NVPKSLIAGAPRFAFRELKKESRETLLKTCLYEVKCLQQEEKSTLKREQIADLEINLAKK
KGIDNLEDHVELRLMRTQQVKNSLLEFAGIADSVVPADDGTFQDDVLLTVQQSNHLINSI
NNPEVRKKRQSLFLDDLPNEKWNVTKPIKYVLDSSLEIKDGKLVMKALDEIGLQTCIKFE
LVEEQPNESHLLFVKIPQSNICGLSYIGRVEDVNPIYLSFACEEVNYHIVEK
Download sequence
Identical sequences Bm1_13915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]