SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_14495 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_14495
Domain Number 1 Region: 657-1043
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.19e-68
Family Ankyrin repeat 0.00000272
Further Details:      
 
Domain Number 2 Region: 433-756
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.29e-62
Family Ankyrin repeat 0.0000173
Further Details:      
 
Domain Number 3 Region: 1012-1198
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.68e-31
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 4 Region: 308-477
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.15e-30
Family Ankyrin repeat 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_14495
Sequence length 1202
Comment | Brugia malayi ion channel NompC, putative (1202 aa)
Sequence
MAMPNDDIISSHLHGGILASALADLQKYDNYNEKIGGNSIPEFRSKSFLINATTNPTKEV
IITPQLTSVYNSPLSTYRGIIGTALRNEISTTTENGYIPSQYEQQSFPLTKRLPXSLNDP
KSMTNSFDHTLSTTNDGSTLQSARIIGQQKGNKRGMISKWXQDITESTPDLSSRKEIADV
LISPRTGILGLLLKKKKGKFRDTQTCKSSNSLSSSLDPTVSETNSFTKESRISQKNQSLL
SLKRHERSHDKHLSLEDLDCPSVLPSPGSTQSRLSRRDESRKNQKANYKKWSIQQSTSKE
SKSSSTSTKLLIDEDEYSKNLPSKLGFTVLFYAVKSCNASIFNKLLNRGALLETITKDGR
TIAHIAAMYGNEGIIRQLLNCKIDFKLGDKTFNQTPLHLACKRTSKRGFRVTQLLLKYWE
DGRLVEDLQKCLPIHYAVKCGNLETVKLLLEIDRNGDSLLHLACRSGDNDMLQFLSSYNQ
IDVNIANSNGWTVLHEVALKGSVPSLRILHKLGANANIFDKEDRTPLHIAAAAGRTNIAQ
LLIEKFGGSVRARTRDGSTLLHVAALSGHASTALTFLKHGVPLCMPNRRGALGLHSAAAA
GFTDVVQLLIARGTNVDIKTRDNYTALHVAVQAGKASVVETLLGYGADVHVHGGAIGETA
LHIAASLTTDDAIECAVMLLKSGAQTNVTRNDGETPLHIAARNPLSGMIRLLLSEGADPK
ICSNSSESVLHVAAKSCNSEAVTLILEYLSQQMSPEEIKEFINARTIEDGLTAVHYAAQI
TSDQLHFPGEDAKLIETLIDYNGQPELQTYKQETAMHLAARSGNEAALLAIVDKIGAGAV
QIVQNKQSKNGWSPLMEACALGHFSVAQILLDHHARVDVFDENGRTALHLAAANGHLKLT
QLLLTSKAFVNSKSKTGEAPLHLAAQNGHVKVVSVLVEHHGALLEAITLDNQTALHFAAR
YGQLTVAQTLLALGANPNARDDKGQTPLHLAAENDYPDVVKLFLKMRQNNRAVLTAIDLN
GFTCAHIAAVKGSYAVVKELMMIDKAMVIQAKTKTMEATALHMAAAGGHSRIVKILLEHG
ANAEDENAHGMTALHLGAKNGFVPILNVFDESLWKKCSKKTGLNALHIAAFYGNSDFVME
MLKRVPANLRSEPPIYNHYVVKEFATEYGFTPLHLAAQSGHDSLVRMLLNQGVQVDATST
TM
Download sequence
Identical sequences Bm1_14495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]