SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_15155 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_15155
Domain Number 1 Region: 512-709
Classification Level Classification E-value
Superfamily vWA-like 9.49e-49
Family Integrin A (or I) domain 0.00022
Further Details:      
 
Domain Number 2 Region: 1116-1257
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000116
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 971-1001
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000151
Family EGF-type module 0.067
Further Details:      
 
Domain Number 4 Region: 921-953
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000229
Family EGF-type module 0.022
Further Details:      
 
Domain Number 5 Region: 123-155
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000005
Family EGF-type module 0.066
Further Details:      
 
Domain Number 6 Region: 1675-1707
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000973
Family EGF-like domain of nidogen-1 0.038
Further Details:      
 
Domain Number 7 Region: 1266-1431
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000173
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 8 Region: 1625-1657
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000249
Family EGF-like domain of nidogen-1 0.066
Further Details:      
 
Domain Number 9 Region: 424-456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000251
Family EGF-type module 0.05
Further Details:      
 
Domain Number 10 Region: 1475-1510
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000362
Family EGF-type module 0.023
Further Details:      
 
Domain Number 11 Region: 378-404
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000039
Family EGF-type module 0.027
Further Details:      
 
Domain Number 12 Region: 961-1123
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000502
Family Growth factor receptor domain 0.009
Further Details:      
 
Weak hits

Sequence:  Bm1_15155
Domain Number - Region: 1523-1683
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000133
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number - Region: 1426-1459
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000267
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 116-273
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00267
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 773-810
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00488
Family EGF-type module 0.063
Further Details:      
 
Domain Number - Region: 479-505
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0061
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 1724-1757
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0343
Family EGF-type module 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_15155
Sequence length 1768
Comment | Brugia malayi Transmembrane cell adhesion receptor mua-3
Sequence
precursorXputativeXXXXXaaXMNVSLVPMNVMKMQNVRTLWMVTIVNVSQVGLII
VQIEKMHLGVVVRKQIYVPVFNVPKKRNVVKLNXDQFVNVSRVMFDISRQHGMAAGHVCR
KVVNECATGKHDCSSSATCIDTADLFTCRCRDGFRDESPDVVNRPGRVCVRAFIPEPPEC
DVNDPMSCDAKKKEVCLFVNGTYKCQCATGYDRLPDGRCLVINECDDQRLNDCASNADCI
DQVIYYCRPGFADISSSFERLPGRRCVEAINECLNPSMNDCSENAICIFVHVYKVLLMHR
PILPIIPGRVCHKPKQEKLHDNGTTKGSIITCNPDKPKCGTNEVCTDRKARGKFVCXCAE
NAFRFTDNTCRFYAACIGVNDCDQNAVCANAFDSYICQCRPGFIDISPDPEGKPGRICKE
LINECATGIHNCSSYATCIDATDGYMCICNDGFVDTSSQFQLAPGRRCSNASNECVDQTL
NTCDENADCIDTPDSYTCQXYAGFVDVSSSANLQPGRVCTVQTTCPKQKTDLMFLIDGSG
SIGSYVFKNEVLRFIXEFVELFDIGLDNTRVGLIQYSDQIRHEFDLSQYTDKASVISAIS
QVQYLTGLTRTGAAIQHMVMEGFSERRGARKEGDDVARVSIVITDGRSQDNVTEPAXNAR
KSHINMFSVGVTDHVLGPELEAIAGSPLRWFHVDKFKDLDTRLRSLIQKAACPSPEPKPR
PPGGCNPSTQTGCDRTLNEGNSSAQCVCPEGFQRHPSTRRCGGNQCNPDLPTSCPHPEIC
VIAPFSNYLCVCPKGYLRDQRSGICLANNTHKIDGKQQNEPTILSSHDADCHNGGVRCGT
NEECVRVATHDFHCECITGYERNLYTGQCSVPGSCDPTLPNPCDVRKRERCMPHSSGRYH
ICQCAKGEKRHHVTGICLQDECASGANDCDRNARCIDTDDGYLCACRNGYLDQSSDLVNK
PGRICVAERDECKDGTHKCSPNAICTDTVQGYVCRCKQGFIDFSPNPQSFGGIICKEVVN
ECQNPSLNTCHKNAICIDTADSYKCICKTGYTDLDELRNPGRNCQKERHNDRCRQGNNDC
DRNARCIEHDGNDYVCACTAGYRDKSPDPNRPGRVCIPLIPECDNPTLNDCDSPDRAICT
DTDEGYLCRCRQGFLDISPNITSKPGRLCKPLENECAKKVDDCAQDGGICEDTPDSYTCR
CAINYLDVSFDRQNRPGRKCKRLVDECQTGQNDCSPEAVCTDTEDSYECACPTGYIDVSP
DTARKPGRRCLLRINECKANRHDCSPNADCIDTAESFMCKCRDDFVDESPDVTNRPGRLC
RPALIDECRLGKHDCHENAICQDLTQSYTCHCKPEFIDQSPNRVALPGRLCIPRPTPPPA
ECRIDASASSCKQELNEVCRLINGQPKCACPINYSRDKVKNSCTVINECDFPQLNDCHPS
ADCIDEPTSYTCRCKQGFKDISSSDKPGRICQPHIDECKLPHLNDCHQNAVCIDKEDGYE
CKCNHGYMDRKPERPGRLCKKMIDECARTELNSCDKNANCIDEEDGYRCECKNGFLDVSP
SPTFRGRACRALINECSDPKLNDCDKTAKCTDTTDSYQCECPPDSKDISPNPAFPGRVCL
VFENECLTGKHDCDPNAICRDNEQSFTCECAHGFTDRSPNRLNRPGRVCVELIDECTSGR
HTCSAQAECRDLEEGYTCECKDGFIDRSPNLLTQPGRVCGTPEVCPSNHECSSAAVCEPL
GGNKYECTCIQGYVDQSPSDKKGRICVR
Download sequence
Identical sequences Bm1_15155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]