SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_15375 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_15375
Domain Number 1 Region: 4-160
Classification Level Classification E-value
Superfamily Kelch motif 1.83e-24
Family Kelch motif 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_15375
Sequence length 163
Comment | Brugia malayi Kelch motif family protein (164 aa)
Sequence
MACWIVTLQGGPKRTTQAAVALNDKIYAFGSCWCTEPAETFGVHVLNTIDYRWQRVPTRL
FQPNPSQQFIDDSGQIYEPYGESPVHRVGHSVVEYKGKIYLWGGFCHEIGVLCSKMYCFD
PEERTWSVIPCASGEATGREKHTAVVFNDMMIVYGGSEDQQPR
Download sequence
Identical sequences A0A0K0JVV7
XP_001894535.1.25112 Bm8431b Bm1_15375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]