SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_16295 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_16295
Domain Number 1 Region: 267-424,483-525
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.43e-41
Family SPRY domain 0.0047
Further Details:      
 
Domain Number 2 Region: 17-79
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000504
Family PHD domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_16295
Sequence length 572
Comment | Brugia malayi SPRY domain containing protein (573 aa)
Sequence
MRQRSTRKGATKPAPSSVCYCDGKREVGTLELYCAVCRKWFHGRCLKDLTDFYGLPFMVC
YVFNCADCSPTKKETWTPKQANFAHMCVTVLANLTHNARTKRASTGNESDDNDQELIFLN
LENEIIPYFNAQWENLTSMSRRVKNTWHQTLQKSLAKETELFESSDDGQVFALRERDLSS
VGPGHEALKQIGRSKPVVSSSTRDLYKENFDRSDDLGDGPKTRGSSKRRYLDPPNTFKKA
KLTADYASTRIVGISAPIDFPFNREGYRYYLVEKDLTVPNRDIFELEESTYNKPIPAHIY
RVVVHPVVTLSPNDRAYQLKLSEDRLSVSGFEGYSVARATHSISHGTWYFEVVFTAQPPG
SHIRIGWSQAVAPIQACVGYTQLSYAWRSYKGTVFHQAKGRHYASGGFKEGDVLGCLISI
PPCPADKEYDFTSVENLPPSSSYLPPSYKNLPLINFKHNYFYEEKDDVPAALKNLKPAPG
SWIEFYRNGKSCGIAFTDIYAGFYYPAVSLFQGATVRCNFGPSFRYPVPHGARGMCERVG
EMYIEQTLADXLYLVENEDELAEEAAKCARNL
Download sequence
Identical sequences Bm1_16295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]