SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_16310 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_16310
Domain Number 1 Region: 217-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000161
Family EGF-type module 0.028
Further Details:      
 
Domain Number 2 Region: 120-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000409
Family EGF-type module 0.021
Further Details:      
 
Domain Number 3 Region: 164-198
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000486
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_16310
Sequence length 270
Comment | Brugia malayi Calcium binding EGF domain containing protein (271 aa)
Sequence
MVGGATHCVCKKGTIRPQGSPRCVLEPLLQQYLNNIIGNCTEIQKDLIEVYGEKISFSND
SPRLTYARKETECNPKSKIPCKGYGEICLPDLSGRHRCTCANNGTRMDSICLVNECMSPE
LNDCDPNASCMDSILSYECFCNEGFIDTSISPKTRPGIKCAKLVDECASKAANQCDENAD
CIDKPIGYTCRCRNGYVDISEGGARNPGRKCHKLMDECQMGLADCDPKAICIDMTYSYTC
KCPHGFADKSADPINKPGRICSKCELLLAY
Download sequence
Identical sequences Bm1_16310 XP_001894720.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]