SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_16760 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bm1_16760
Domain Number - Region: 94-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.014
Family EGF-type module 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_16760
Sequence length 195
Comment | Brugia malayi conserved hypothetical protein (196 aa)
Sequence
MLSISSVAINEIIIAISCDIFMNIMNSKPVNIFKIKFSCNNGSSIGGRCICIRGYSGTYC
NRVMHCKFNKFQSNGSCVDCSDGWKGINCDQIQCIHGVSDESGQNCICEMPYSGQFCKSL
ETSDVYFYYNQKVYQFGPIGALSILPLLVILFGCERTAQSRRIKRIEKHLYEQNIIVNRH
KISTFLTRKTKMTSN
Download sequence
Identical sequences Bm1_16760 XP_001894809.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]