SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_17050 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_17050
Domain Number 1 Region: 125-310
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 7.69e-41
Family AlkB-like 0.0037
Further Details:      
 
Domain Number 2 Region: 350-497,538-563
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 7.89e-21
Family UbiE/COQ5-like 0.035
Further Details:      
 
Domain Number 3 Region: 19-95
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000462
Family Canonical RBD 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_17050
Sequence length 576
Comment | Brugia malayi conserved hypothetical protein (577 aa)
Sequence
MDRSKVSRKLRKCLLQLQKHDPDVEISSVPTEILFVANSSPLCGLSYDELERIFSQFGEN
CDFMVFQSQRSYSFVIFQTVAVAHLAYQKLHGHMPSDLNSNALPFYIAFVKNVPSVKRIE
PLYKPNNLWVLPDFINPDEEAALITVIQDYLPRGKTLKNRKVIHFGFEFNYDNNMASEQP
SPDPIPSVCQPVIDRMLGAGIFKEKPDQVTVNIYEPGNGIPSHVDTHSAFSDTIASLSLL
SDLVMEFRDFANTSTIYDVLLPRFSLTVMRGESRYRWKHGIAKRKYDINPVTNKLMARQL
RVSFTFRNVIREKCQCAFIEYCDWDRNGAMKVPDSDEFGAAIENQYVSAVYESIAEHFDV
TRHAQWNGVAKFLSKFEPGTIVYDIGCGNGKYLXLDDALIKIGCDLCYNLCLIANQKQCN
VLRANILSLPFKNSSAGAVLCIAVIHHLTTKKRRIHAIQEIIRVLQPGGQACITVWAYEQ
KLCDAPSEYLKMRQKKRDVQMNRRDSHGRLRVHEGREFTQPDMLVPFQNADGSRFLRYYH
LFRDFELGDLISDAGGCTVEKYFYEEGNWIAYIMKA
Download sequence
Identical sequences A8P5P3
Bm1_17050 XP_001894867.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]