SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_17575 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_17575
Domain Number 1 Region: 76-159
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000101
Family Ankyrin repeat 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_17575
Sequence length 313
Comment | Brugia malayi G-patch domain containing protein (314 aa)
Sequence
MDSSGNVSTIEKYKQIRFIRANPVTNVQASIPENSSKPTTCGEEARSFYETLLAEPSTST
VPXIRMTAQLERTSKRSRKSTKLLNDISKKQDSVSVNFESLFKDAADGNLQGVMDYYCKK
GMDTNVSDQYGWTALMCASYAGHLHIVKYLLSVGVNISKRIRXEPSLRKIKRSRKAMDVT
RFCDACQCTYVGEAHLSGIAHLLETRKPVLDPGYGIPEWNKGYRILRKNGWDEFEGLGRN
ATGRRYPIKTVLKRDKLGLGCATADTPKVTHFKANDVNAVKTWPSKRRKQMTNHRILHEK
ILERRFRSMFRDD
Download sequence
Identical sequences Bm1_17575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]