SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_18060 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_18060
Domain Number 1 Region: 83-254
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000105
Family Fibronectin type III 0.0068
Further Details:      
 
Weak hits

Sequence:  Bm1_18060
Domain Number - Region: 298-342
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000276
Family Fibronectin type III 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_18060
Sequence length 355
Comment | Brugia malayi hypothetical protein (355 aa)
Sequence
CITGCNRRRMTARREKNGTTNALMAGMQFWMDTNAYASRTDHSPIKSVQLGCMDVVTSQD
VSDFEDTIEGLVFVNTNETEQYPIRYIVQWKQRTYDGSPTGENGWITASIESEPIFKVEG
MIPMMQYRFMVTAVGPGGRLGGPIMSNWAQSLTVEEKLRAPGIGPMMIVTQYNNEDGLCA
LVKWYHSPYQLELSPNILDDRLVLFGNCHYSITILNETSQETVLFTLDNGNGILLSNLQF
STEYSVAVRSISSVMVVDSSMLQQKNMSTAGDTNDILEQKFFTPACNEVFGSGSLECAPE
PVKNLEAIINPNGSVQIQWIPSSEPNTILVYQLLYQSLTNHHDCDNDPSSIYINA
Download sequence
Identical sequences XP_001895070.1.25112 Bm1_18060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]