SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_18125 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bm1_18125
Domain Number - Region: 114-162
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0282
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_18125
Sequence length 253
Comment | Brugia malayi hypothetical protein (254 aa)
Sequence
MLAANGDGPAMPGISDVLRYLENEPVMLHALQEFINMTQQRDSLLNARLTEVERRLAGYE
GRNAQQEVEVEEMEEGPAPQEPEFNIEEAEWAPLPESDDEADWLAEAERAPLPDSSEESP
EVPVAPVEASVCGICNRQFGSLKGWRIHTSRMHKQDGFCARCGHYLLLPPNFTAAQKTAA
LELHALDWCPRACAAVMKERQVKRRRLNLVGREEDTHHLFVPVTSSGIPHAVNLSLPVPT
ISPPPSSEAGQAG
Download sequence
Identical sequences A8P776
Bm1_18125 XP_001895083.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]