SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_18720 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_18720
Domain Number 1 Region: 84-303
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.69e-46
Family Ankyrin repeat 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_18720
Sequence length 541
Comment | Brugia malayi protein phosphatase 1 regulatory inhibitor
Sequence
subunitXXAXputativeXXXXaaXMDHSDLVAELGEIEKMTPAERIALARERRRIQLR
NWDEREKQMTPTLPRRQRLKFSPEVALLEATSRGDAVEVERLLLEGANPNSHNEDGLTPL
HQATDVNAQDTEQWTPLHAAACCAYIDIVRLLIDNGANLLAVNADGNMPYDICDDEATLD
VIESEMASRGITQAYIDDQRGAAEKQMLDEMKLLRQEGHPLDVRQADGSTYLHIAAANGY
YDVAAFLLRCGVSPSVRDNDLWMPVHAAACWAQPDLIELLCEYGGDINAKTNNGETALDL
CEDTTTRAVIVTVQQQEARKKRLAFGVRDSRRQSRKRKKFESPQQPTANTDNPFSARGAI
XRLSLRDRSGMTLARMEAQKEQTDLLRSWSKEDVSFGKDEANSANNSATSGQSGVESTNH
AAGQFEIRRRDSPSKKIIKPSSQKTKPMSPDEWLRKLDKENGCIEDDDETSLQLQRGGRT
RSSQKKKKKANSGATEVTVLQNGGGSGSDLLSTISTHGMRRSDFPDVIRRHQKKTCCCTI
T
Download sequence
Identical sequences Bm1_18720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]