SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_18920 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_18920
Domain Number 1 Region: 11-30
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000979
Family PHD domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_18920
Sequence length 210
Comment | Brugia malayi AF-10 protein, putative (211 aa)
Sequence
MPHSDRGYVDLSCYGIVEVPEGEWYCAKCADFIAHSQYNGNNGDVGEVREIPRCKLCPFG
HGALKRTDNDEWAHVICALYIPEVRFGDVHSMDPVILSDVPLERFQQQCYLCMERGEEKR
AYLGACMPCNKPGCKKCFHVTCAQAEGLLCEEGGGSKNVKYCGYCAAHAKKARLFAGGNK
EEEVSEGKKSFEGTCIESNCHLSLVGFGSI
Download sequence
Identical sequences Bm1_18920 XP_001895241.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]