SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_19860 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_19860
Domain Number 1 Region: 17-64
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000045
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_19860
Sequence length 82
Comment | Brugia malayi hypothetical protein (83 aa)
Sequence
MFIQLLPVEGFVSEIAVNEMGISMVRFTKDLLFSSVQQTDQGLYQCIASNAIGERSTFIG
LIVEAEIDSVITNLEVTVDHTK
Download sequence
Identical sequences A8P9K2
XP_001895427.1.25112 Bm1_19860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]