SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_19945 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_19945
Domain Number 1 Region: 25-201
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-26
Family Laminin G-like module 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_19945
Sequence length 212
Comment | Brugia malayi Thrombospondin N-terminal -like domain
Sequence
containingproteinXXXXaaXMTTYAGERCDNFGTTYIFDSSLSAIYYEYPKSIQPS
TNRDEMAIGFRTRQANAVLLSVQCNVDGDFLTVFLKNAHLHIRYNLGSRDHDVGLSSALL
NDDKHHAVIIYRQEANLTLYIDNREPIYYSPLGGDMELVTLNMQWRIAIGASFNLLHRTK
RRKREQIYDSYKGFITGVNFNGLMILDMLAQD
Download sequence
Identical sequences Bm1_19945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]