SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_20050 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_20050
Domain Number 1 Region: 31-102
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000068
Family Integrin domains 0.0051
Further Details:      
 
Domain Number 2 Region: 187-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000181
Family Integrin beta EGF-like domains 0.016
Further Details:      
 
Weak hits

Sequence:  Bm1_20050
Domain Number - Region: 157-188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000218
Family Integrin beta EGF-like domains 0.012
Further Details:      
 
Domain Number - Region: 236-262
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000229
Family Integrin beta EGF-like domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_20050
Sequence length 394
Comment | Brugia malayi EGF-like domain containing protein (395 aa)
Sequence
MEVPFKYLHRPQQSSQRDFVIQTSEFRSLGVGIDFSILCGGKRVQGRQCPNVAIGDQIEF
FAKVSLNECKSGGDIAVSIGAYGYQTVSAMYITPSCGCECEKVQNQEKLSPLCYGAGDLI
CGVCECQPGKGGNHCECDLKQHGALSAQELENRCRKTPKDLVCSGNGQCKCGSCVCNVEH
VRGDYCECENMSCPTSNDRMCAGQGECKCGKCHCEEGYTGDDCSCTLDTSSCLEGGKICS
GQGSCECGKCVCYEGFTGLTCGVVAENEALDDEMPESSDGEMDGSSKDDVSKVGYDQFQE
ENLDEVTENKAKEGEEYAEATEGYEMDGQEAGEILPSVDDDTGSTSAELTETRAEAGDSG
NDGDITHEGQTAGCLRIEIHSFILLISLMMLFWP
Download sequence
Identical sequences XP_001895465.1.25112 Bm1_20050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]