SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_20595 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_20595
Domain Number 1 Region: 506-778
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-70
Family Protein kinases, catalytic subunit 0.0000529
Further Details:      
 
Domain Number 2 Region: 115-469
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.92e-60
Family Ankyrin repeat 0.0000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_20595
Sequence length 884
Comment | Brugia malayi Protein kinase domain containing protein (885 aa)
Sequence
MGNYKSRPPSSCADELKKKISEGYAVVRSRLNDDIKPRFDAWNMLQNACFQGTLKTLEES
LKSLKNLDERTEDHQLSLLHLICAGHSEQQSEKVAILFEACGDDDMKKESLLKHLSKNGF
SALHFVVYKDEIETMEKLLAAGANVDFSGRNKLPPLHLAVMCGNIEMVEKLIDRGASLQI
ADFVNFTPLHCATYFAHEKIVRLLMRRGADPNACGGVRDRPLHLASNKGQISIVSALLEA
DADPTLTDDEGNTSLHFAAKTGHVGIIDLLLLKIGAGHQELALKTNIYGDTPLHTACYAG
RLDAVKRLLDFGGSITLNMENVFSETPLHAACTNGRNLELVAFLLKQPGVDANFQGQDGH
TALHSACYHGHLRFVQFLLDNGADQSLTARAVDYSLLPSSTPVSSTIVQTMLSLSKESAS
SVTAGSSSVSSASLNDDQQQTPIIWAYEKGHDQIVALLKYYANKRPDSDVCSEYSSGESS
YTPLPSPLGRLRSVTKEKAEILQLRASLCSQFHLSLTDVDFQEAIGSGSFGKVYKGTYRG
KIVAIKRYRAVAFGSKSEVDMFCREVSILSKLQHPNVINFVGACLDDPSQFAIITEFLVN
GSLFSLLHEQKRVLEMALRLNIGIDVARGMRYLHELAKRPVIHRDLNSHNILLHEDGHAV
VADFGESRFMAQHDDENMTKQPGNLRWMAPEIFTQCGRYDRKADVFSYALCIWELHAAEL
PFAHLKPAAAAAEMAYKRGRPPLPPHPTVQFPAHILYMITSAWHHDPKSRPAFADILPNI
EKYASPVKSPNGVPPSNTADCGLLSVSKLKNHWERKGIPQESTQHSSAITFSTSSSGIVS
SSSTSSILSSLSTSTKTIDELRQRLDRNGYVLQPVIAVDNTSIS
Download sequence
Identical sequences Bm1_20595 XP_001895573.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]