SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_20640 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_20640
Domain Number 1 Region: 39-175
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.46e-34
Family Galectin (animal S-lectin) 0.00072
Further Details:      
 
Domain Number 2 Region: 178-309
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.91e-32
Family Galectin (animal S-lectin) 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_20640
Sequence length 311
Comment | Brugia malayi Galactoside-binding lectin family protein (312 aa)
Sequence
MIKSFVSGKNLYILRKVRKECEKLINLSHVAHPGDAAIPVPYISKLGAKLQPGQTLVIHG
SIENDASEFEVNLLNGSPNIESSKATIFHIKVYFKENRLVYNTYENGKWGKEEKSSNPFK
KGDNFDLRIRIHEDKLEIFGNQKELHIYKARINVSSVEYLTIRGNISLKGVHWGGRYYTL
PFETQFPGGHLKADERIYVYGIPKGERFEIDFVSRNGDILFHFNPRFKEKQVIRNAQIGD
IWGQEEREGIFPFKKDIGTDIILHNAPYSIQIFIDGKRYGTFAHRTIKPDEDYMALRIAG
DFELTGMEFTI
Download sequence
Identical sequences A0A0K0J7D1
Bm1_20640 XP_001895582.1.25112 Bm2767b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]