SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_20665 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_20665
Domain Number 1 Region: 450-561
Classification Level Classification E-value
Superfamily Bromodomain 6.02e-31
Family Bromodomain 0.00054
Further Details:      
 
Domain Number 2 Region: 148-220
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 6.42e-17
Family PHD domain 0.0089
Further Details:      
 
Weak hits

Sequence:  Bm1_20665
Domain Number - Region: 264-298
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000842
Family PHD domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_20665
Sequence length 811
Comment | Brugia malayi Bromodomain containing protein (812 aa)
Sequence
MLDRIVSTCMDGRTVRINVMQPLTVNFVTDDQLSVEDRSSAVMAKYKESSGVTAALPKVN
VRRLSPKPLSCKNFDIPKAYIKYRVRLNEEMDNILEYDVDEEDMEWLSLISKKLEKAGEE
RLSVHSFEIAMDRLEKESFFQCSKGDGNYKCLVDQDAVCCVCNDGEGSNINQIIFCDMCN
IAVHQDCYGVPYVPEGQWLCRRCQMSPSKPVSCVLCPSSHGAFKQTVDSRWAHVVCALWL
NEVHFANSVFMEPIDGIENSLRRRQRLRCIVCKQKVGACLQCSRKSCTRSFHVTCANAAG
MEMRAEIVDNPKREGGTEIRYTDELMKKAREKLAASQAVIPPVSIPTVPHESLKRICEKA
DISENVIRYIVAYWSLKRKSRFGVPLLRRLIHSKTLPKSADASPTSGQGTHPSETRTYFL
LRTNLERVRLLCELVKKREKMKKEFYDSTASLLNRLTKPLNTIMSEVIEKIASKDYSDVF
AKPVTEKEVPGYSTVIKNPMDLSTMRKKLAKGDYKNLSQLKSDFTLMMNNCSTFNRHNEF
FWKYGHRLHRIGLKYFRVAEKDVQALTLANGVLKTISSISYTPVEGPKLDNEEENDDGLD
FVPRKMSTCRSSKGEKTLPTRVSTRKRTLRTFDDSITPKRPKYNLAIESFMTYRSDPLKS
PKFLTTDTSTMEESSSADEEIHLRRGRRRNTRKCRKLIPPQPMERPVETVEVACEFQHDD
IVWITENDERKIGRVIDLRMRVLLDDLPTDEMFSAKPHDYMQYVLVLYFDGQKNWRWVSV
KYVSYCLVKSIKAEDYPPAVREALREAKAFL
Download sequence
Identical sequences A0A158PZE3
Bm1_20665 Bm4016a XP_001895587.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]