SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_20815 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_20815
Domain Number 1 Region: 202-460
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-43
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 24-180
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.4e-36
Family Ankyrin repeat 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_20815
Sequence length 467
Comment | Brugia malayi integrin-linked kinase, putative (468 aa)
Sequence
MSLSSNYHSHKPNVPIIMEDVFGWVREGNTFQVRVWLDDTEHDLNIGDDHAFSLLHWASK
EGHVAIAELLLSRGARVNATNMGDDTSLHLAAAHGNREIVVKLLNRKADVNVANEHGMTP
LHYSCFWGYVQICEDLIRSGALIGTCNKKGQTPLDICQPQARNAVVEIAREHGQNINERT
PFKDQTWKGTKTRTRDATLSRYTGVDMASLSLSMKIAESHSGELWRGKWQGNDIVARILA
VPEVTPRISRDFQAEFPSLRIFAHSNICPVLACCNQPPNLIVISQLMSFGSLYNVLHEQT
AVVIDQAQATKFALDIARGMSFLHSLDPLILRYYLSSKHVVVDEDLSAKISMADTKFSFQ
EVGRLYSPAWMSPEALKYSPSDLNIRAADMWSFGVLLWELNTREVPFSDLSPMEIGIKIA
LEGLRVPFPPGISRNMGRLMNICLNEDPGRRPNFDQIIPILEKMAQS
Download sequence
Identical sequences A0A0H5S8R0 A0A158PQS9
Bm1_20815 XP_001895617.1.25112 Bm2471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]