SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_21440 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_21440
Domain Number 1 Region: 1187-1515
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.36e-82
Family Ankyrin repeat 0.0000137
Further Details:      
 
Domain Number 2 Region: 311-668
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.92e-76
Family Ankyrin repeat 0.00001
Further Details:      
 
Domain Number 3 Region: 617-767
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.64e-33
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 4 Region: 1769-1849
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000126
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_21440
Sequence length 2481
Comment | Brugia malayi KH domain containing protein (2482 aa)
Sequence
MKNQKKSDCNLTTRDQMGEKTMSESHSALFFIIARSPDYRNRFYILQLCCQNDIKIRSRL
FALMDSDSVRLTDSSIKKSEKVAPAGTSAASKMRILNSKRGRVRIMNELKPFLPLLPDIA
DMEIKEQKHLFQQLYSAGIAASASLHKWLTMSAAQQFPRYCAKFGGTACIGGMKDDLCID
STQVEKAYDIATTIQNTQLSPSQQIPFTSEDAEALKTLSRSGILDDAVESLRQFPSLEED
LLGLKEDLAAASLITPDIAAAALSAFAAATLRRPPTRTIESLMASSQDPVTTNGGPDSTD
DESLELNLSEDESEDNGDMLLNLAVSAGYLDLTKELVEIRGNPNYVNINNDRTPLMEACC
AGHSDIVKHLLEHGADMNAMSATKNTPLIYASAAGNVECASLLLDYGCDITIRNDNGHCA
LMEAASSGYLDVVSLLVQHGFQVLPCNQNDLKVGLESALTLAAYKGHYDVVQYLLEKGAN
KYKEELHTALMEASMDGHYEVAKLLLDNGAPVNLASDSFESPLTLAACGGHPDLVRLLLE
RGAIVEEVNDEGYTPLMEASREGHLEVVRLLIKFGAKVNIQTDETGETALTLAACGGFKD
VVELLVRSDAHLDIGANTPLMEAAQEGHLDTVRFILSEMCSLGLPIDATTTANSNTALTY
AAENGHLDDHQAENGRTALMKAAKNGNYSVIQFLLMRGAKVNEVSTDNDASALFLACAHG
HWEIVRLLLDHGADPSHVFKDGVTCMIEASRNGHTRVAETLLNWHDAPIVTRTPLLGKPP
ALQNSRLKKVARRTVNKKATTIIQPKVECAEKSMNNMAVDIDDKMGCSDGTAVSTSTTAI
TTAGMHSQCTHDSQLLSGTHNIPTNASVPAHLLAHYNYQNAINPDELRGMIAGMAAMAAQ
SNALPNDHLFAQIAEKALRGTFANSEISGGLADKKMHQQFSELLKQQFSILANRQKDALA
GLGGANSLPDSENGGSTSYSPSVTSSPSPPVIACCETTAAHAAIVHSPNLAADTRRKGST
SNERQKTIVGRGTQQKKGGKNIILSDGEQRACLPSASLRFPAPPPPVMNANVPRESVPLS
LPLSPSKVRHSLRQQSPPLTKQLISDPAIGRQRSKPVREATGDESSIDRNTSRNRGRTLS
ESAMHVGDGQHTTERTYDTDSDEEISKRSGLKSGSSQPFNVDMQTESNHDTALTLAATGG
HDSLVELLITRGANIEHKDKKGFTPIILAATGGHVNVVEILLNHGANIEAQSDRTKDTAL
SLACSGGRKEVVELLLKRGANKEHRNVSDYTPLSLAASGGYVDIVNLLLNNGAEINSRTG
SKLGISPLMLAAMNGHAAATKILLERGSDINSHIETNRNTALTLACFQGRTDVVRLLLEY
NANVEHRAKTGLTPLMEAANGGYVDVGELLLTAGADPNSSPVPSSRDTALTIAADKGHHK
FVEMLIHARAVIDVRNKKGCTALWLACHGGHLETVQTLVKHEADVDVQDNRHVSPLIIAF
RRGHIKVVKYMVRHVQQFPSDTDCYRFIATINEKELLTRCHLCMDIIVAAKDRQAAEANR
AAESLLEIIAKEEELAKSKKLSKQRQNEKKKAKRKAKKNQADGNTERKDSDHKEDASINN
GEESADEENGSEKTSSAATVDENNTRNRDSEHEYCPTDPPRVPALLSDEHSADETVLVPE
CSPTKRVMVSSTPVAGKPSRHRVRKESGKSAAPVKSPPHKTGSGNTSDTEWMKATSRRSA
GKTVMSGKSAASGTTSKEDSASNTVPWRHVDLSRRRSTRLSVSSNSIARVIGRAGGNINA
IREATGAYIEVEKQTGKKEQHDRQITLKGSDVALRQAVDMIHGLIDDSECNVEEVIQRVS
STHITSISQSEENASRSSSALTLSGTTPTMTVPLTQKKSYAIGTAASHTPLEISNNGAAG
KKTAPYVATTNVWAQRAAQRQSQKVVSAIGSEKKQKMSSGATEQENSNPNQTAQTPGTVY
STPEMQVIDTAEDGMQKHGVKEFCRAPGHARPTSASASSPSVSPIGLKSPIHVGPSSTMV
TPSTGTTIPTTTITDPKSRTELFEAGSKIEFLQNIPANAPLPSSSDIAEGSLQPLLGTAK
SNLDALKTSSIDDKLFSSLDSTHQSIIPSSIANIWDDNIVDDKPWAVPVTLAPVQLEDFA
KNINVQLPTSTKPAGDYPDPSRTADHMVDLAKNIASLRTSESRPVNTTGNEAATGRIFLG
ENMPPFDLNVPFSNRDPVDWGNAGPFPTDTFTRWRNAQLDSTPITGSAQEIDSSSWIDQA
SVAARLASTRQEHLPFPTTTYAISGNSGHLTSSFGSDVANVNLGHQQSTQAWNRMHFQQA
AQAASNEYENLTNLLSSYRPTVSSQHQPVPSQQQQPPQPVVPMGNINYSAAPAAVGPTGF
RIPVPRSQIANTSVPPPPFFNSQIPPPSSMSHRGGISVTQSSPNAAWSSVHFGGQVQTTV
TENIQFPQYPSAARGNWGYNW
Download sequence
Identical sequences XP_001895742.1.25112 Bm1_21440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]