SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_22615 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_22615
Domain Number 1 Region: 76-447
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.22e-82
Family Ankyrin repeat 0.000026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_22615
Sequence length 1571
Comment | Brugia malayi KAP family P-loop domain containing protein (1572 aa)
Sequence
MGLSQTSEVNDKKKPTFRKDYVHFVDYLTTVHTLHIINLRRMAADPKTDELFALLENGQF
RSANFPKQDFTTLRNADNENVLIVAARTGQTDIVREFISDFDLEDTDADGWTALLDAAYM
GHEEIVKILLEAXAAVDYPDMLGWSPLMWAVYKNHYACAQLLIQFKAHVNIIDEEDSLTP
LIVAAGRGYIAFVELLIGAGAEVNACDKFGSTALIWAARRGYKPIIELLLDAGAELDAVG
MYGSTALMMATRGNFIGVVKLILSREPNINTVDQNGLSPLAIAAREGYVEIASMFIQLGA
YVNAVDRFGNSILAGAVRSGNVEIVKMLLEKHADVNARDSENRTALHLAIDKSFMDIAVA
LLERKPNLEIRNKDGDTPLLRAVKNRHVGFCQLLVNSGAKVSATDNAGDNVLHVALRARS
RKITQSLLLNPSDSRLLYRPNKLGHTPYSIDQENPQPIIPLIYGPLDAEVQVDAMLGYDI
YSNVLADIVCEPNLTLPLTIGLYAKWGSGKSVLLDKMKNSMRSFSRSWLDAVQLSWSWSL
IFSVAVLIAMFTLISTAAVTFLQNFHYIIIVGTCGLIFFIMWLLLYGLIYYGNSVKGWNK
SIKVARSIAKFLAHMRLLSNVALQHSASVRDKDLLSCPVSFLFADYHRLSSVGGEQALAK
IVATLFEAAENHFGSLPVRLFCALKVSFARGNKPKTRRACGVPITVMVLLLLFSISTALI
LLSLWLYNGMNLHSSYLFGSVLFFIAAVVLTLYPLYLLFVYGFVNMPKRRINIAARKINK
LRFEGFMQKLQHEVNLLANMIRSLDFFTNSQTRLIVVVDGLDNCEQERMVQTLDALELLF
CTHADRPFVVTIAVDPHIIISAVNHSMHSALAGTGLTGHDYLKNIINMPFYLHNSAIRQL
QTNLHNKRESLADWKERFKRQETFHGSYVSLREGFEGKSSRKVTVVGTRGLSRSLIADDY
FSNMNPRSMKRIVNALTLTGRLMRAFEIEFSWVSLGYWVSLIEQWPSRMCWLIDRALDIP
QDSYPLAQLYNHLKQQIPTKDPLIDLDRNPDNFESFLEQASMIGPEQLTVGHVRRFVPCT
SNLDPYLRKLIRECRIGTAQPVKSFVNRSSNLSGLILTGPAWHLFKDKNIWRGIEVPLVE
MKLSDIIDLVKKLDIPSERISVIAEKMNTSNLTGLVLSACDLSEVQETLKLNLGDWTLLK
LLIETLRTWKPMTLMDNVETPSLISPIPVLAISTSPSSMQEQKDRLDMQTEMEGDHKWIL
ESFSGMDVAEVDDVLPASSVPSVHFDDGVASERDSTESVCGSYENLLDSESIXQTRSENM
NVMTRRARYGLQHRYKREELGSTAVVDSIHSDVSNTGTQSRSASRIHLPIILDISDNQQT
VREGFWKKFSEYREQAAVYYKQRFIILLKGKAPNNYYVWSSYPLLNHAEETHIRIAVIEE
YESDFNDDGKPDLIELNVTFPIERKDEVFGVFYMFLFDFQLDERSRFSMETAVLDDLDHA
TESSSLTVSGDLWLDQAAPLWSSGRDPDHGGALINESSLDLAQYNPTTILLRNSFRNFTT
TLRRLAKLKFV
Download sequence
Identical sequences Bm1_22615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]