SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_22640 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_22640
Domain Number 1 Region: 55-216
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.33e-37
Family Ankyrin repeat 0.00099
Further Details:      
 
Domain Number 2 Region: 251-312
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000129
Family SAM (sterile alpha motif) domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_22640
Sequence length 432
Comment | Brugia malayi conserved hypothetical protein (433 aa)
Sequence
MAGAVRSVRFSDDLPKISHNNTTVRNIIKCYEQTSQTPVQLPRVYDDALYSPYDVYTAAS
MGDTPVIEAQLETGFDANRLNGSGWSSLMYAAYLGHEAVCALLLRSGALVDLCNANGQTA
LMLAATCGNLAVVRLLMRKDAAIDKQDNMGDTALAYATACSQASIAEALLDNGANPNIPN
LHGMTPTLTACCIGHELTLLALLQNDGDPKLXNAKGEDGEALAFDNPKTIAILKDPPRSK
RKKNNTEKKAMEVNSLTELLSQLKLEKYIEIFETENIDLNLFLELSDADLMEIGIKAFGP
RKKMLNVIQQYRTDGTLIPCTNDTKVVQYTYAKDRKQSESHSQQVTNELMECQQRLAECQ
QELKQARNLLNEHRSTLSSISEACRHSRKIAYTMLQEIRQTNGTGSTLENDVLAVIKNID
NILMRMLELPQQ
Download sequence
Identical sequences Bm1_22640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]