SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_22700 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_22700
Domain Number 1 Region: 229-430
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.81e-43
Family SPRY domain 0.008
Further Details:      
 
Domain Number 2 Region: 153-257
Classification Level Classification E-value
Superfamily Fibronectin type III 4.04e-17
Family Fibronectin type III 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_22700
Sequence length 441
Comment | Brugia malayi SPRY domain containing protein (442 aa)
Sequence
MVAELSQILQLLSEKAKHATEDITRLKQLNDAISVNCFDFQHRLTVQVDSLIEQLQERKQ
KLLQYVEEEKEFKRRIFKEQIGRCTTKLSKTTALIQFCIEVLKEPDPATYLQVSSALINR
ATTQEFLWHKEMQTTPEADPEFILNLDVNNLQYAIQTLDFAQLKAPNAPLIETAECVAEN
NSVTIAWKAQNDDCAIDGYILEIDSGSDDGLFKEVYCGRDTICTIDGLHFNTVYNARVKA
FNAAGESSYSDMICLQTAGVAWFQLNKSASQNDLTISNECMSVTGTTMEYRTLCGSIAFS
RGIHYWEVTVERHAGNADVVVGVAQNAFNRGIMLGKDLHGWSMYIDGERSWYLHNGMHHS
RIIGGISVGSVIGILLDCDKGTLAFFVNDTRRNYEGQLVAFRNMPHGLYYPAFSVNCDTL
ITVHTGLPIPSSSGSSDCSDT
Download sequence
Identical sequences A0A0R3R2N2
XP_001895996.1.25112 Bm1_22700

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]