SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_23350 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_23350
Domain Number 1 Region: 37-70
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000212
Family EGF-type module 0.036
Further Details:      
 
Domain Number 2 Region: 71-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000523
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_23350
Sequence length 111
Comment | Brugia malayi EGF-like domain containing protein (112 aa)
Sequence
KDAQKDSKEMGKIITKTSDEKPSGNLGLIKTDEEAICEDELCNNRGTCIGNKDTNFCICR
LGYTGMHCENSPCDSTKDCNGKGLCIGTSTSHTCMCQLGYTGENCEKNVRK
Download sequence
Identical sequences XP_001896127.1.25112 Bm1_23350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]