SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_23485 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_23485
Domain Number 1 Region: 3-167
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.74e-23
Family Leishmanolysin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_23485
Sequence length 224
Comment | Brugia malayi RH66426p, putative (225 aa)
Sequence
IPYQNPLPTEYRNFASLNGVKNKDAIYYGGSVELADYCPYNQEFEWKAPNSSQRRDSRCE
LDGNFTPNQANSIMEVYGNQSKCFDLATFWTERKCGRIRTFLQYKAGCYQYECSEGRLNI
GLFNESFFYPCYFTGQYVYIRKVINGWLREGVIICPPCEEICHSEHFSVDDKFGYCQETN
KDNIPEYVGDLWLDEPCAASTSFSFAIHESYISRCGYFLSCFAL
Download sequence
Identical sequences Bm1_23485 XP_001896154.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]