SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_23550 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_23550
Domain Number 1 Region: 93-212
Classification Level Classification E-value
Superfamily SET domain 0.0000000000000196
Family Histone lysine methyltransferases 0.068
Further Details:      
 
Weak hits

Sequence:  Bm1_23550
Domain Number - Region: 50-75
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0233
Family PHD domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_23550
Sequence length 236
Comment | Brugia malayi SET domain containing protein (237 aa)
Sequence
MCLVVDAVERTVKLVQIGDCSNSKYCLLQKLSEKQLKTFGILLAESELEDDDYIHCDLCG
VYYRASCRLHPLFIVSDREVREDNKPRAEQTLPAFFEIKTSKIPKAGLGVFAKMDIPIGL
VFGPYQGILLSDPKKADQNGYSWEIRISGKPSQYIDGSDPRYSNWMRYINSSRFENEQNL
IAFQYNGSVYYRVFRPISEGIELLVWYGNKYGESLGVLSVTQRHKIPLEKNPYIFG
Download sequence
Identical sequences A8PEK8
XP_001896167.1.25112 Bm1_23550

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]