SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_23560 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_23560
Domain Number 1 Region: 15-216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.49e-63
Family Calnexin/calreticulin 0.0000335
Further Details:      
 
Domain Number 2 Region: 199-313
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 7.72e-45
Family P-domain of calnexin/calreticulin 0.00000182
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_23560
Sequence length 404
Comment | Brugia malayi calreticulin precursor, putative (405 aa)
Sequence
MQLYLLLGLVCFSAVSAKIYFKEEFSDDDWEKRWIKSKHKDDFGKWEISHGKFYGDAVKD
RGLKTAQDAKFYSIGAKFEKGFSNKGKSLVVQFSVKHEQDIDCGGGYIKLMASDVNLEDF
HGETPYHIMFGPDICGPGTKKVHVIFHYKGRNHMIKKDIRCKDDVFTHLYTLIVNSDNTY
EVQINGEKVESGELEADWDFLPPKKIKDPDAKKPEDWDEREYIDDEDDKKPEDWDKPEHI
PDPDAKKPEDWDDEMDGEWEPPMVDNPEYKGEWKPKQKKNPAYKGKWIHPEIDNPDYTPD
DDLYLYGDIGAVGFDLWQVKSGTIFDDVIVTDSVEEAKKFGEKTLKKTKEGEKKMKEKQD
EEEEKKRKEEXEKKKEEEKEEEDKEEEEKEEDEKKKDDETHEEL
Download sequence
Identical sequences Bm1_23560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]