SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_24345 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_24345
Domain Number 1 Region: 1-33
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000753
Family PHD domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_24345
Sequence length 47
Comment | Brugia malayi hypothetical protein (48 aa)
Sequence
MMFCDRCDRGYHTFCVGLSTPPNGNWICSSFCSDYNVTAXDDSTCNE
Download sequence
Identical sequences Bm1_24345 XP_001896327.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]