SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_24440 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_24440
Domain Number 1 Region: 2480-2660
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.02e-27
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 2 Region: 3011-3165
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.47e-26
Family Laminin G-like module 0.0021
Further Details:      
 
Domain Number 3 Region: 2670-2852
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.91e-25
Family Laminin G-like module 0.0082
Further Details:      
 
Domain Number 4 Region: 3175-3355
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-18
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 5 Region: 877-923
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000279
Family Laminin-type module 0.00071
Further Details:      
 
Domain Number 6 Region: 2272-2391,2422-2455
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000602
Family Laminin G-like module 0.03
Further Details:      
 
Domain Number 7 Region: 1169-1217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 8 Region: 838-879
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000809
Family Laminin-type module 0.0068
Further Details:      
 
Domain Number 9 Region: 290-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000879
Family Laminin-type module 0.043
Further Details:      
 
Domain Number 10 Region: 1074-1122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000977
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 11 Region: 760-808
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000012
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 12 Region: 976-1017
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000204
Family Laminin-type module 0.0088
Further Details:      
 
Domain Number 13 Region: 1582-1634
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000246
Family Laminin-type module 0.046
Further Details:      
 
Domain Number 14 Region: 1024-1071
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000134
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 15 Region: 1525-1568
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000229
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 16 Region: 417-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000024
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 17 Region: 929-971
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000218
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 18 Region: 1122-1166
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000067
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 19 Region: 487-524
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000725
Family Laminin-type module 0.04
Further Details:      
 
Domain Number 20 Region: 1632-1678
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000921
Family Laminin-type module 0.0075
Further Details:      
 
Weak hits

Sequence:  Bm1_24440
Domain Number - Region: 347-419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family Laminin-type module 0.025
Further Details:      
 
Domain Number - Region: 98-171
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00391
Family APC10-like 0.033
Further Details:      
 
Domain Number - Region: 723-762
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family EGF-type module 0.036
Further Details:      
 
Domain Number - Region: 2135-2238
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.00837
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_24440
Sequence length 3357
Comment | Brugia malayi laminin alpha chain, putative (3358 aa)
Sequence
MGCLAFRSYLFIITIILTVYFGDTERADQDYDNYQEFAVVEGQHGLFPTIFNLATNALIY
ADATCGQHNREIYCKLVEHVFNRQPQCDVCDANDVRKRHPIEFAIDGTRRWWQSPSLANG
LDYERVNITIDLRQEYQVAYVIIKSAIAPRPGTWILEKSLDGINYQPWQYYAVSDAECLR
QFNVPATTGVPRFTRDDEVICTSYYSKLDPLENGEIYTSLVNGRPSAEAASETLQQFTRA
RYVRLRLMSLRTLNADLMIINRRDKSNRLDLSVTRRYFYAIKDISIGGQCICHGHAESCP
PDPVTGQSRCECRHNTCGESCSKCCPLFNQLPWRQGTQLHPNVCQPCQCFNHATHCEYDE
EVERLGLSVTPEGIFEGGGKCIACKHNTDGINCERCMWTYFRPSGVTHYREDACRPCDCD
PIGSEHNNCVRDETSADGDQKPGDCICKPGFGGRRCDVCAPGYRNHPKCEPCPCNRAGSL
NFDTCEEEHCICKANVEGVYCDRCKEGTINLDMKNSKGCQPCFCFGLSNKCHEKQWNRGE
IRSTTGWVLTDLSGEKIVPPKSENEVLMYTNSEYRNNDLYYWKAPKEFNGNLLNSYGGNL
QYFVYFVPMGNGEETSIPDVIIEGNGIKLEYYSQQNFFPRENISIQIPMKEDSGWHNSHM
RTPTDKHEMMRVLADLNTMLIRALYNKEQIQSSIYGLTLDTAIESKKTAESTDGLLPNTL
MRGVEVCQCPEYYAGNSCERCISGYRRVNNQLFDGHCEKCNCEGHSFECDPFTGDCINCQ
HNTTGRRCHQCLPGHYGNPSLGGEFGQCHPCACPTIENSHSALCSLTQLIVGGAAAYGED
AYVCTACEHGYDGNKCEICADGFFGNPLIKNGTCEPCNCNGNIDPMTIGNCDRKTGKCLK
CIYNTAGDHCEKCKENHWGNPKDKSCRPCGCHPKGSHSATCDKLTGICDCHNNYVGMQCN
RCKDGHGDIENMCPACSCNMTGSFSSECDEVSGQCACKTGVFGKQCDMCRASYFNFSENG
CEFCHCNAFGAIDDGRCDNVTGKCECRKNVEGKMCEKCANGYFNITSGLGCQACDCDSIG
SKGIQCDTHTGQCDCKSGVTGLKCDKCAPNHFGLNANGCKECRICPAPGHICDSITGECI
CPPNTIGEMCENCSSNAWNYDPLNGCTLCDCSGIGADGPNCNPQTGQCNCRLGFVGLKCD
RCIHGYFNFPQCELCNCDLSGTDPATCKNGACLCDEIGQCSCKKNVIGLKCDSCDAYSFS
LEKSNIFGCTDCFCFNRTNFCVQSSFVWQQIYASDRQVIFSEPWKYYIRKHNLNVLREKP
LIYNSYPTDITPLYWPLPSSFLGDRTASYNGFIRFTIKNDDNYRGITNVAPDPQHFRFFP
QIILVGNHRIILEHTPDEVNQSGRYKIRLHESQWRSRLSPDVPVTRKQLMIALQNLQGIY
XRATYNYPSTGDTASINEISIDVAVWDNTTDTSNSVAIGVELCECPQGYAGYSCQDPADG
YCRKRQPDFLNSPDDLALIGGPQPCICNGHSTTCEAETCRCTNCEHNTYGDYCELCKPGY
QGNALVGGANACTKCACPLPDNSFSDTCLAVGNDGGYMCDACKPGYTGMHCESCLTGYYG
NPNVIGGMCNECACHQHGSIHGICNQETGQCECRPGLSGRDCSLCKERHAFMNGICTSCD
QGCTRDLMKEMDDLEEIMRQQNFTNLRPIPWKRAARISNTTKSLHLTLESLQLESSIDDD
TTKSSLNIDDNFLDEVNGLVEQTKFLLERTNKSKNTLQKSIAKTEKLSERAREQEEILHE
VVGQLRNYINYGFGKQDSSKIGILIQEANIHVNAMKERGIYIEKRYNRGKTDFEKSQNLM
KLITSRMLNDTSFVELRKQLDAFEQWLHDYRDTIWDRARQDTVSSDKVAIIVAKRVNRFN
DVKANITELLAKATDELSEAENKVSIAKAEKILAMFDDFKLINETVLPQVDEMTRKCRDE
ADKYGQLLDAYHEEYVEKSEHHAAALEDEAQKLKNSFADTKDAAADPVRASNAYKEILDA
LRNASEAAEGAKKAAEFAYIDADPKSDISMVNMALQAKNRSMDIKEEADELGLKDLEKER
LTANMDLNELKETLQNSMKRKIGISKXGPSFESEQYQSFDDQHDRMTGLISVVDDAEKRA
KNVHQKMQEISVEIATMSDAVSKLKGFAGQGIRNVTNDVRKANQGAQEAMKKVSEVKKQT
DSXSKRINVLGEQIKLLQEKIKEAREKASRIQISMKSDEKGDCRRAFXSPAHLAPTNLFT
IKYRPLRNVPDSLLFLTKTKTKRTQQSEYIAMELRDRRIVVHWNIGSGIRMATNTHTINY
IAPSDRTAWYHIVLERFGNSVTLTVALHHTISGEGERTVGEPTTVSVGQPDEDDSIIFNT
VHGETLIQFGIEAKLSQDLGLATNKFLGTIGEFTVDGETLPLWAFAESTRVCEGDFAAPE
SQATGYFFRQVFFYLKIHLQHFSNIMDGFAQIHLPSTERPSGAQITVILSAYSPNGLIYF
RGNQENGDFVCLELREGHVVFRINLGDDSYALVKSKKSSYADGRSHTVRVIRNYDKIHLQ
VDDESDRNSATIPGENAXLNINGDDHFVGGIPPGFNTTAFRNFDIHWNEFFGCIQSVRPS
QVAELDLDNPIRSQRKLRGCTFRNGERLEPTDRVVSFNRPGYLVVQGIQLSNNSTFAFAF
RTKTANATLLFQSSELETFRRRRKIRDSIGTGYLAFYLYRGYLVVHLGTDSSQKSKVLTL
RSETTYNDGQLHSIFFTRFETLVRLRVDDREVASGTLGEQNTIGTASSQLFIGGFPDGIK
PSANEMPIAESMIGCVSNIFIDYRLVPIIPEAHIALIGTCPVEQIFSLQKSERRTDVEAL
QADEQNAFNQKASKLSLHLTEPTLISKTERLYADGSVKANPVNIREAINDPEELESNNLE
QSIVAIDATTFNVIPTTGNLIGSAERKNDDDDDSTTYFSTLTDFGPKKCGSNLLAKNDGE
GAARYGIAEASHSKLNFEDDDLDTNQFKIKFAFRTILPNGMLWIWANYNNYTRYFFLNLI
NGLLQFQVRGRKEPKILFYKSNKLNDGQWHDINMLKKGQEILLKVDRNPAQYLKDVSNPK
LIRKRMYIGGVISKHRKQFNLTVPSFSGCIRNFEVNDIQQDLFAKSRHVVPCVNSNSAYV
HEGGYMTFGSLKSIRQFGNIQISVQFRPAVKDGFIFGLMTNKDPENARIAVYLKNSLVTF
ELVYNNEHHELKHIFKKDLCDGSWHNVTLSISHSNIIVITVDGHRKRLQLKMSSELIEFF
RNLPIYIGGVTASSTSKIGVLSLIGCYRDLQFYGKVMAFKDAKKLNKVLPDGCPFLN
Download sequence
Identical sequences Bm1_24440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]