SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_25290 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bm1_25290
Domain Number - Region: 134-210
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000971
Family Fibronectin type III 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_25290
Sequence length 611
Comment | Brugia malayi hypothetical protein (612 aa)
Sequence
IQTAPPVYNADDGTVVVYISWENPTGYTDEDIYGYEGPAIYPVQCNSPEAELPSPSVELK
KGGGRLRISLPSEVLDSKCRVWAEVQMLPRCIRLEPFSIQQSFELNCDKLTNLEVCKHEI
APQCTDVIDIWGYGSNATIMWSPLDNFGTPLYYHIRYGPAKMQGVPPLASWTIASLHEMK
TIGNSTNLQLHIVPDIDYGIQVCAVYNEHRKQPKFELLRVIPFICTSCKITPAESFGRCG
ECTKIEGPLLLGRRCHPKGGTGCTLAGTISNISDIKDDDISRNPLTVLPSDVFIDSPSDS
TKSKMNNRXSISLIHENSNTLIPQLPTKSTTKLQTSLTESEAQIIEQSADEFSINENEAK
ETTTLHNSQSASVISNLRSAIEVSTLSTLSTLSTFAQQSQTATAPNKEKLQSNLTSCTLF
NGVICEFGCIDQTKCNCPQGTRVLMDNGACLSQSSDKPPFVCLSTTDVKANWNPWIHTLQ
IRSKKIYDEIKMHTNYDRIFLEFGXXKYIMKGQIPSNEVIFDERNEKSNKVVIRTNIFHL
NGIQFERDLMRNIVSNEQKQITKMAFVIVPIILIVLLVFLLAAIIYMNCARLKRCYDRRK
TRHFRPIYVEW
Download sequence
Identical sequences Bm1_25290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]