SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_26760 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_26760
Domain Number 1 Region: 486-759
Classification Level Classification E-value
Superfamily YWTD domain 6.8e-49
Family YWTD domain 0.000000903
Further Details:      
 
Domain Number 2 Region: 173-212
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000615
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 3 Region: 267-305
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 4 Region: 216-253
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 5 Region: 37-70
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 309-347
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000458
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 7 Region: 126-170
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000929
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 8 Region: 427-465
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000147
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 9 Region: 103-126
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000117
Family LDL receptor-like module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_26760
Sequence length 888
Comment | Brugia malayi Calcium binding EGF domain containing protein (889 aa)
Sequence
MXKSSPKMFISIAFFIFVTLVGFLEGIETTGSKECSEDNQYKCNNGKCIPLSWRCDGDED
CPEGDDEDKCSRISCKTDREFECVGDSIGLPLYASKIRDYPARCIPKTWVCDGEPDCRDS
SDEKGCQNITCEKDQFVCEEYKGHARMCIPMTWKCDGQNDCVDMSDEKDCQKTRTCGTNE
FQCDNGVCIFKNWLCDGDDDCGDGSDEDHEKCPNTTCDATEKFQCRSGGTCIPRMWVCDG
EADCKDHSDEMDCSDIGTVISQNPHMVTCHHSFEFPCRNGGHCINKAWKCDGEMDCADGS
DEENCDKRVCTANERTCDMGRCIPANKWCDGFDDCLDASDEKDCTPPAKQEKCDENTEYR
CPGTPLQCIKLEDLCVDGKPNNDCLKSVCSSHLNLSLCDDSSNNHCKCRTTKFNGTICHC
PRGFELKGRSCIDIDECAQIGICAQKCINVPGGYVCECYPGYHLTMGRSTGTNKSAGICR
AKGSDPLLLLSNRATIRRFDLVTNKYEPLVAKLDSAVAMDFLHRNDTLIWSDVSQEKIMI
CHMGKGLKTLQDVRGCAEGEHNITLIDKDVSTPDGLAVDWVHQLLFWTDTGLDQINVLDL
VTRKRRTLFSENLDEPRAIAVDPLRGLIFWTDWGLSAHIERAGMDGNNRTVIISGEMIKW
PNGLALDILEQRLYWADAKVKLIMSCDYWGQHIRLVLRSHERVKHPFSLTVFEERLYWTD
WDQEGVLTANKFTGSDFKTVMNGVSGPMTVRVYHELAQPDHPNKCASHECEHICLPKAHL
PINRDAHFLLKGRPYTCACMNGFIAYLWYHKRPTSFAVLHVDNPVYRRTVEEVDADMDPF
ADAPSNSNGIHRGVKLVIDQDQQWKYNPVSAPPPTTSSTSLSIPVWAI
Download sequence
Identical sequences Bm1_26760 XP_001896803.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]