SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_27255 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_27255
Domain Number 1 Region: 2-146
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000177
Family Fibronectin type III 0.0074
Further Details:      
 
Domain Number 2 Region: 166-233
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000104
Family Fibronectin type III 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_27255
Sequence length 254
Comment | Brugia malayi Fibronectin type III domain containing protein (255 aa)
Sequence
MSRSCVISWTAPDDSLTPISQYHICVDSIVRAVVPGSFKCKALIEDIDLSKSINLSVRAV
TENGHSPDAACTISLGKDAPIAPQHVRIWSITPISACVSWYPSDSKAEHVILLNAVKVGM
CPPSVFQVQLNGLLPSTIYRVSVRTKHPKAVLEQRPVERCCDFKTLPKIGLPDPPSNVQV
EMGPQPGTLLVSWTPVTNQPLPPSRAAVHSYLVYADGRNIAQVPSVNGKHVNFNYQCLII
KSVDMFQLKLHTIF
Download sequence
Identical sequences Bm1_27255 XP_001896897.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]