SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_27445 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_27445
Domain Number 1 Region: 31-102
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000262
Family Integrin domains 0.005
Further Details:      
 
Domain Number 2 Region: 187-225
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Integrin beta EGF-like domains 0.018
Further Details:      
 
Weak hits

Sequence:  Bm1_27445
Domain Number - Region: 236-263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000195
Family Integrin beta EGF-like domains 0.027
Further Details:      
 
Domain Number - Region: 157-188
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00106
Family Integrin beta EGF-like domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_27445
Sequence length 352
Comment | Brugia malayi EGF-like domain containing protein (353 aa)
Sequence
MEVPFKYLHRPQQSSQRDFVIQTSEFRSLGVGIDFSILCGGKRVQGRQCPNVSIGDQIEF
FAKVFLNECKSGGDIAVSIGAYGYQTVSAVYITPSCGCECEKVQNQEKLSPLCYGAGDLI
CGVCECQPGKGGNHCECDLKQHSALSAQELENRCRKTPKDLVCSGNGQCKCGSCDCSVEH
VRGDHCECENMSCPTSNDRMCAGHGECKCGKCHCEEGYTGDDCSCTLDTSSCLEGGKICS
GQGSCECGKCVCYEGFTGLTCGVVAENEALDDEMPESSDGEMDGSSKDDVSKVGYDQFQE
EDLDEVTENKAKEDEEYAEATEGYEMDGQEGMKGVNIIRKFNYYLFLFHLYI
Download sequence
Identical sequences XP_001896942.1.25112 Bm1_27445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]