SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_27545 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_27545
Domain Number 1 Region: 1746-1805,1834-2054
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.32e-51
Family Protein kinases, catalytic subunit 0.00026
Further Details:      
 
Domain Number 2 Region: 29-105,177-374
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.62e-39
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 512-633,712-783,846-863,890-974
Classification Level Classification E-value
Superfamily L domain-like 5.92e-34
Family Ngr ectodomain-like 0.015
Further Details:      
 
Domain Number 4 Region: 989-1011,1039-1208
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.31e-22
Family G proteins 0.0095
Further Details:      
 
Domain Number 5 Region: 2099-2393
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.00000369
Family Quinoprotein alcohol dehydrogenase-like 0.019
Further Details:      
 
Weak hits

Sequence:  Bm1_27545
Domain Number - Region: 86-154
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0596
Family Ankyrin repeat 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1_27545
Sequence length 2507
Comment | Brugia malayi Protein kinase domain containing protein (2508 aa)
Sequence
MDEKSSPEETGQLVYEAVMYENEELLRELLEANPGKVYYRDKHGRSALHIAAQNGNLPIL
DLLIEAGVWLVQVHCVLLLYTLPQLRGRLEAVRHLIEAGAELLATDLRDHCALELAQMAN
QFETACLLIDAIESVRNKTRQLHDDLVKSAEEGDIRTVIETLPNLTSANYDAVLNGATLD
RKCVLHLACLNGRKEVVEALLNVRGHTLIQPNTHDTVLHAAISSQKAIIVEMILKAFTHL
VTAKNADGSTALHCASQCGSLDIVKLLLEFPYEEDVLTKIEDISGRFSYRFVLDVNGLDA
HCRTALYLAVANSYYDIVKYLLEVEFPSMDIDQKCPFEIDVYCSGGKTPLMVAAANGDIA
LVKLLVDHGADVNLPCGLTEADISSVDGARCIGSGALNEACRIGCVSLVQFLLQRGAVDH
ENVALATAFKYNRDSLARLFLLRLAFVDPEYRVNKKNIDLGQMSSNRNQLSSAVYPTTPC
MLNWHNASLEAVSNDWLIAASLQVNQRLRTSRMALAALTRIDLSKNKMKILSGQLLQLPS
LRSLNAANNEITEIEVPSDGFHAPLLESLLLEFNKLSVLPDELFTNKLSMLNFLDVSHNK
LCSLPETLWSASRLRELNVSNNILSVLPAIGFLQFRPSSSLSETEQPESLYSDLYTHQSN
LSTDDSLSIGGRNDDSNITIHELKRHNIWQTSIRLARSEESDTENGPMFFSSMISVFNVS
HNNIKVMPSCLACCCPYLTRLNISHNQLTSLGPVQCLPSRLRHLDASNNQLVTAFERPTA
VQLVCHAVNTSSNEISPMRHTSPLRNSRSRSKSAVRSQRSLSVAPAGDTLCDTFIDACSH
KQHTRLESLRTFLVANNRLTEIPLLVPSSKIISSPKKKQRESRQRCSAARRQILFPALTT
LDVSNNFVSNVPAALSNLVSLSVLNLSGNSGIEMLPPELGLLSKLWNLILKGCSLRDPLK
SMVHVESYKTVNLIAYLKSVLEDSRPYTRLKLMIVGVQGIGKTSLLQQIRLEGTVGKRTS
PNDSWSKRMGHSTGSGGDRTAKGANISTVGVDIGEWTFEPKKTKGEPTFGPLTFRTWDFG
GQREYYATHQYFLSRRSLYILVWKVTDGETALPDLRQWLVNIQARAPNSPVIIVGTHVDQ
IFSNSERFPPTYLEDLNALIRDHFVMVSDADKKGLPRVVESLFVSSKTKQNIRALCNLLY
HTAYDIRTANSKERLLDQKIPASYMALEKIVVELADERRSKGIEPVMRNSDFRATXQERM
LKNYGRAFRDDIEFNHACSFLHENGVILHYEDVTLRELYFLDPQWLCDILAHVITIREIN
PFARNGLMKIDDLQVLFKSLNLNNSAINLRSHIISLLQKFEVALXWQSRSLLIPSLLPDE
YQLRGGYPGSRVLVPTRTTSWQLTVKQREAKNSLIMKASHLQMQTLFSQRNLGGKRYRTT
VPLTTILNSHEKSSASVSVGRNESGCDKGIPLIDEHRCTVNMEYLEQEVVRRIYMMAYIP
SGFWSRLMTRVLVDDHITMCMERLLEVEYLSEDSSLETLNELCDRKFLPYWLLWQTGFEI
LAFEKTIFVMRQFLPLAEVRDVHYETVEWRCCAEDSNWRTLDISGSSLIEIIIPAVRINL
VSDEKEYVLRSNRAAVTRLLALIVDIMDTLLEDWYPSLGTRFVHTSEGCLLVNRLVPCLK
CASSTRNLDAFFKVKKNDDIICDSSPKHKLHAFMVEECILSAHDGVNLRCPLHFDISVVD
IAPDTVFLDINEDYLIQPNSVKRGKLIGHGAFGFVFKAALKISDANAQDVALKMLEPVEP
GLGARVSSVSAYKAAYTKWQRDPLQNACRAYCTCRQELNVLASLQHSHITALMGVCPRPL
ALLVELAPLGALNHLLNNYRRSGARLRLSVIQDTASQVAKALEYLHEHRIIYRDLKCENV
LTWRFPPPFSTITDVLVKLGDXGISRSSFPSGGAKGFGGTEGFMAPEIMRYNGEQEYTEK
ADCFSFAMFLYELISLKLPFDGHEQLKEYVLDGGRPRLTPSELLYPCNVLDVMVVCWAAQ
PVDRPSASQIVSMTTAPEFTHLLDVISLNDPDSAVNSSISFSTVDDVEFGSAIEDSVEGE
VWMSRSDGSVTVVSCNQYGWLDSKSIIMNTDKTVILAMCVVADNVWLAESTGILRIYCRS
SYSELWSFSISRFLPTAHLSISVISLSVFIATPLLILVTLPSALLLVKGDRITDNPFVSS
IGLSTVHSSAIIDYGQNGKQIWTGHEHSSISIYDVTLENQLVLSANICHEENQVNAVEKS
CVSHMVTAETDSALLWSVLSHGSKVYQWSTSSRMIRNRLDSRKILPSSESISTLDIEASR
DGYVSALALLDRTDGAQLYIGTSRGAVIVAQAFEMRPLAAFRPYVEDVHTIIVLDVASAL
NEYIRTRKDLISVTSLEKRSFGANSTDSGDNSLEGVSRVKDRLSETVNRFRQGTTERMSS
LNSYVITIGNGYRCLIDRFTDRKHQGSTTLRRDSHCAIIWRTDEWVS
Download sequence
Identical sequences Bm1_27545

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]