SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_27790 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_27790
Domain Number 1 Region: 51-159
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000771
Family I set domains 0.062
Further Details:      
 
Domain Number 2 Region: 166-274
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000124
Family Fibronectin type III 0.003
Further Details:      
 
Weak hits

Sequence:  Bm1_27790
Domain Number - Region: 3-41
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000496
Family I set domains 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1_27790
Sequence length 308
Comment | Brugia malayi Fibronectin type III domain containing protein (309 aa)
Sequence
MYKKLSLVFTQIAKRDTGIYKCVARNSRRISANWKVEIIVVDEIHWKENSDVVGGMFGES
LTIDCGSIGNPQPETYITNHNGFPLNAQICCNVTRSNPPARHFRYLKGSDELRNDTNHII
LIDALNQRSCLKILSPTEYDLGEYRCEVSNGKSRSQQTIAVKEATPPGEVHVSLQDVGMT
YVLWKIEEGFGEQLPIRRYIIEYIKKSILEQSRDQTRENNRVWFAHAVKMNVHLNKDGLY
EIGGLRQGTTYIFRFTAENEAGIGDTVTLAVKTTSGIKLSKLTRSASLSLQQLTLIPFIL
HFFPTWPV
Download sequence
Identical sequences Bm1_27790 XP_001897009.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]