SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1_27925 from Brugia malayi v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1_27925
Domain Number 1 Region: 963-1013
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000019
Family Laminin-type module 0.0088
Further Details:      
 
Domain Number 2 Region: 319-369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000131
Family EGF-type module 0.08
Further Details:      
 
Domain Number 3 Region: 852-898
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000053
Family Laminin-type module 0.00085
Further Details:      
 
Domain Number 4 Region: 753-804
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000586
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 5 Region: 481-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000248
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 6 Region: 1011-1059
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.0071
Further Details:      
 
Domain Number 7 Region: 434-481
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.0096
Further Details:      
 
Domain Number 8 Region: 925-965
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000167
Family Laminin-type module 0.0038
Further Details:      
 
Domain Number 9 Region: 809-854
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000544
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 10 Region: 378-436
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000017
Family Laminin-type module 0.035
Further Details:      
 
Weak hits

Sequence:  Bm1_27925
Domain Number - Region: 715-755
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00419
Family EGF-type module 0.077
Further Details:      
 
Domain Number - Region: 134-211
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00723
Family Galactose-binding domain 0.063
Further Details:      
 
Domain Number - Region: 1119-1349
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0212
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.012
Further Details:      
 
Domain Number - Region: 1538-1638
Classification Level Classification E-value
Superfamily Fibrinogen coiled-coil and central regions 0.0353
Family Fibrinogen coiled-coil and central regions 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm1_27925
Sequence length 1650
Comment | Brugia malayi Laminin-like protein C54D1.5 precursor,
Sequence
putativeXXXXXaaXMEQYDELILHRQPCRTNLRVLQLIYILIWIIEIVLSQPAEQNPS
IDPNHHIPGSSPCYXXLNIPQRCVPDFINAAFNLQVEVTNTCGVNGPVSYCVQTGHSGVR
KVCDICDSRVETYAHPPAYLTDFNNANNETWWQSETMNEGMQYPNSINLTLRLGKTFDIT
YVRLKFVSPRPESFAIFKKTHPDDDWIPWQYYSGSCRSTYGILEKAPILPSNEAVAQCTR
EFSDISPLTGGNIAFSTLEGRPSSQNFEESETLQEWVTASEIRIMLTRMNTFGDEVFRDA
KVLRSYYYAISDFAVGGRCKCNGHASECVKSTGDGEDRLVCRCEHNTMGADCDQCLPFYN
DRPWQVGTAKEANECITCNCSHLSNRCYFDQALFERTGSGGHCIDCAGNTQGAHCEECAP
FNWRRPGEHYCIPCQCNEIGSLSMQCDDHGQCPCKPGVDGHFCDRCMSGYYGFSISGCKN
CLCDKTGSLNNEPVCDSETGSCSCKLNVEGQQCNKCKPGYFDLSLDNQFGCTPCFCYGHS
SICTSADGYYGMNVSSNFDSGKEFWSAASLRGPEDIQWAEMDKAIAVSDIDGSPVYFVAP
IQFTGDQRASYNQDLWDILIVGQEGQELTIPIFAQENPIPSVNEQTYRFRIHANPVFQWS
PRLNELDFIGILSNVSALKIRGTYSIEGDVGFLSNVHLGSAGLATSADEPREAHWIESCN
CLEGFIGQFCESCAPGYRREIKYGGLFDRCVKCECHGHSTSCAPESGECICEHNTTGDTC
ERCSRGYYGNALQGTPDDCTKCPCPEDGPCVLHTDGDIICTDCPTGYTGRRCDVCADGFF
GNPGEGKSCVECSCSGNIDPNSIGNCDSLTGECKKCIYDTVGFNCEECKPGYWGDALLEP
KGDCKACNCFAPGTKRSNVDYVLLECRQSDGQCNCQPHVIGSRCDQCQPGYFNLTSGSGC
QECNCDVLGSVNSTCDVLTGQCLCKAGVMGRRCDQCEPQHYGFGLDGCQPCDCEVIGSES
PQCDVITGQCLCRDHIEGRRCDHCIENRYNLQAGCLPCDDCYTLTQSRVHAFRNDISVLE
ETLKEIVENPAPVDDVEFDNYVKAVSAEVEDLANVVNKKLAGGDSQIIEQVNMLRSDLKN
ALKLLSSVDDIINKANKKATTIDETLKQWNLVKDRARSDLENALYYLETEGKTQWELAQE
ASRKYGEQSQQLSEIAQEARKLAEQQENRSIEIEALAEKIANTSKQALVEAKEVIFGGDA
TSKEIAIMMERLNATEKLLNQTRKLAEEQLTEADRAYKAAAESLTVVEGLRLPNIDPQQI
EEEAKRVAEDAKATADNAKEQAAANKELIDEAVRLIAEAKYELQRVQDQQKVSDELLADV
DAAKARAMEAVSLAENTLTEAQHTLEILNDFQERVDATKSEAIEELRNLKEIEKEIALAE
ETTREAENAIGNAKNDARMAEKIALQAEKEAKSISKEAYELRNQTQYVRKTAEQLKSDAN
QLVSDVKETSTTMEDYRRQASSDKARASEAVQKAQLAEKAAEDANKTISEAQDSLRSIIN
QLNSLDGVNIEELDELEKQLDQAEELLNSADLDKQVSLLKEQKIEQDRTITQFRNEIDTL
KDEVQNLEEIRDSLPNKCFNVINLEQEGHK
Download sequence
Identical sequences Bm1_27925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]